B7-H4, Recombinant, Human, His-Tag (B7x, B7S1, B7H4)
Catalog No : USB-172315
598.87€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | B7-H4, Recombinant, Human, His-Tag (B7x, B7S1, B7H4) | ||
|---|---|---|---|
| Catalog No | USB-172315 | ||
| Supplier’s Catalog No | 172315 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 26.7 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% | ||
| Form | Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.4mM KCl, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% | ||
| Description | Human secreted B7-H4, also known as B7x and B7S1. Source: Recombinant protein corresponding to aa29-258 from human B7-H4 at C-terminal, fused to His-tag, expressed in HEK293 cell expression system. Molecular Weight: ~26.7kD AA Sequence: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKD ELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYK TGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELN SENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAHHH HHHHHHH Endotoxin: <0.1EU.ug Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved