VTCN1, Recombinant, Human, aa26-258, His-Tag (V-set Domain-containing T-Cell Activation Inhibitor 1, B7H4)

Catalog No : USB-375850
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name VTCN1, Recombinant, Human, aa26-258, His-Tag (V-set Domain-containing T-Cell Activation Inhibitor 1, B7H4)
Catalog No USB-375850
Supplier’s Catalog No 375850
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 29.6
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. Source: Partial recombinant protein corresponding to aa26-258 from human VTCN1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD AA Sequence: IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.