Thioredoxin, Recombinant, Human

Catalog No : USB-T5010-11
377.02€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Thioredoxin, Recombinant, Human
Catalog No USB-T5010-11
Supplier’s Catalog No T5010-11
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 11.9
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% by RP-HPLC, FPLC, or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified. Endotoxin: <0.1ng/ug (1EU/ug)
Form Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O. Can be further diluted to other aqueous solutions.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% by RP-HPLC, FPLC, or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified. Endotoxin: <0.1ng/ug (1EU/ug)
Description Thioredoxins are small disulphide -containing redox proteins (within the conserved Cys-Gly-Pro-Cys active site) that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. Thioredoxins are involved in the first unique step in DNA synthesis. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase. Recombinant human Thioredoxin is a single, non-glycosylated, polypeptide chain of 96aa having a molecular mass of 11.9kD. The pI is 4.67. Amino Acid Sequence: HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA Biological Activity: The specific activity was found to be ~3IU/mg. Activity was assayed by measuring the change in absorbance at 650nm at 25°C using 0.13uM bovine insulin containing 0.33mM DTT (pH 6.5). Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.