TrxA, Recombinant, E. coli, aa2-109, His-Tag (Thioredoxin-1)

Catalog No : USB-375690
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TrxA, Recombinant, E. coli, aa2-109, His-Tag (Thioredoxin-1)
Catalog No USB-375690
Supplier’s Catalog No 375690
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 15.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Source: Recombinant protein corresponding to aa2-109 from E. coli TrxA, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.8kD AA Sequence: SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.