Toll-Like Receptor 7, Recombinant, Human, aa861-1049, His-Tag, Myc-Tag (TLR7)

Catalog No : USB-518126
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Toll-Like Receptor 7, Recombinant, Human, aa861-1049, His-Tag, Myc-Tag (TLR7)
Catalog No USB-518126
Supplier’s Catalog No 518126
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 29.5
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Source: Recombinant protein corresponding to aa861-1049 of human Toll-Like Receptor 7, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~29.5kD AA Sequence: HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.