Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa1-66, His-SUMO-Tag
Catalog No : USB-370542
578.18€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa1-66, His-SUMO-Tag | ||
|---|---|---|---|
| Catalog No | USB-370542 | ||
| Supplier’s Catalog No | 370542 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 23.61 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals. Source: Recombinant protein corresponding to aa1-66 from centruroides suffusus suffusus Beta-mammal toxin Css4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.61kD AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved