Beta-mammal Toxin Cn2, Recombinant, Centruroides Noxius, aa17-82, His-Tag
Catalog No : USB-372442
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Beta-mammal Toxin Cn2, Recombinant, Centruroides Noxius, aa17-82, His-Tag | ||
|---|---|---|---|
| Catalog No | USB-372442 | ||
| Supplier’s Catalog No | 372442 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 9.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals. Source: Recombinant protein corresponding to aa17-82 from centruroides noxius Beta-mammal Toxin Cn2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.6kD AA Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved