Cerato-ulmin, Recombinant, Ophiostoma Ulmi, aa26-100, His-Tag (CU, Dutch Elm Disease Toxin)
Catalog No : USB-372726
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Cerato-ulmin, Recombinant, Ophiostoma Ulmi, aa26-100, His-Tag (CU, Dutch Elm Disease Toxin) | ||
|---|---|---|---|
| Catalog No | USB-372726 | ||
| Supplier’s Catalog No | 372726 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 9.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss. Source: Recombinant protein corresponding to aa26-100 from ophiostoma ulmi Cerato-ulmin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.6kD AA Sequence: SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved