KP6 Killer Toxin, Recombinant, Ustilago maydis P6 virus, aa28-105, His-SUMO-Tag (Killer Protein 6)
Catalog No : USB-373946
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | KP6 Killer Toxin, Recombinant, Ustilago maydis P6 virus, aa28-105, His-SUMO-Tag (Killer Protein 6) | ||
|---|---|---|---|
| Catalog No | USB-373946 | ||
| Supplier’s Catalog No | 373946 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 24.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Source: Recombinant protein corresponding to aa28-105 from ustilago maydis P6 virus KP6 killer toxin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.6kD AA Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved