Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag

Catalog No : USB-517797
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Alpha-Cobratoxin, Recombinant, Naja Kaouthia, aa1-71, His-GST-Tag, Myc-Tag
Catalog No USB-517797
Supplier’s Catalog No 517797
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 37.8
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105nM). Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370nM). However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446): is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release. Source: Recombinant protein corresponding to aa1-71 of Naja Kaouthia Alpha-Cobratoxin, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~37.8kD AA Sequence: IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.