Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Leukotoxin, Recombinant, Aggregatibacter Actinomycetemcomitans, aa721-1055, His-Tag (ltxA)
Catalog No			USB-517985
Supplier’s Catalog No			517985
Supplier			US Biologicals
Source antigen			Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight			38.3

Storage			-20°C
Other names
Grade			Purified
Purity			~85% (SDS-PAGE)
Form			Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note			For reserch purpose only
Purity			~85% (SDS-PAGE)
Description			Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media. Source: Partial recombinant protein corresponding to aa721-1055 of Aggregatibacter Actinomycetemcomitans Leukotoxin, fused to 6xHis-Tag at N-terminal, expressed in Yeast.. Molecular Weight: ~38.3kD AA Sequence: IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.