Toxin 3FTx-Oxy6, Recombinant, Oxyuranus Microlepidotus, aa22-81, His-Sumo-Tag, Myc-Tag
Catalog No : USB-518130
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Toxin 3FTx-Oxy6, Recombinant, Oxyuranus Microlepidotus, aa22-81, His-Sumo-Tag, Myc-Tag | ||
|---|---|---|---|
| Catalog No | USB-518130 | ||
| Supplier’s Catalog No | 518130 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 26.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Expressed by the venom gland. Source: Recombinant protein corresponding to aa22-81 of Oxyuranus Microlepidotus Toxin 3FTx-Oxy6, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~26.9kD AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved