V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Recombinant, Mouse
Catalog No : USB-157280
395.41€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | V-Rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Recombinant, Mouse | ||
|---|---|---|---|
| Catalog No | USB-157280 | ||
| Supplier’s Catalog No | 157280 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant Mouse from E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 36.8 | ||
| Storage | 4°C/-70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% | ||
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥95% | ||
| Description | Source: Recombinant Mouse from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q04207 Fragment: Gly18~Tyr306 (Accession No: Q04207) Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-GPY VEIIEQPKQR GMRFRYKCEG RSAGSIPGER STDTTKTHPT IKINGYTGPG TVRISLVTKD PPHRPHPHEL VGKDCRDGYY EADLCPDRSI HSFQNLGIQC VKKRDLEQAI SQRIQTNNNP FHVPIEEQRG DYDLNAVRLC FQVTVRDPAG RPLLLTPVLS HPIFDNRAPN TAELKICRVN RNSGSCLGGD EIFLLCDKVQ KEDIEVYFTG PGWEARGSFS QADVHRQVAI VFRTPPYADP SLQAPVRVSM QLRRPSDREL SEPMEFQYLP DTDDRHRIEE KRKRTY Epitope Tag: N-terminal Tags: His-tag and T7-tag Molecular Weight: 36.8kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. | ||
Product Details
© 2020 Imugex All Rights Reserved