Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			ASH1L, Recombinant, Human, aa2433-2548, His-Tag (Ash1 (Absent, Small or Homeotic)-Like, KMT2H, ASH1-Like Protein, Ash1, HuASH1, EC 2.1.1.43)
Catalog No			USB-298323
Supplier’s Catalog No			298323
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			14.2

Storage			-70°C
Other names
Grade			Highly Purified
Purity			Highly Purified (~90%)
Form			Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol.
Reactivity life			12 months
Note			For reserch purpose only
Purity			Highly Purified (~90%)
Description			This gene encodes a member of the trithorax group of transcriptional activators. The protein contains four AT hooks, a SET domain, a PHD-finger motif, and a bromodomain. It is localized to many small speckles in the nucleus, and also to cell-cell tight junctions. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to aa2433-2548 from human bromodomain ash1 (absent, small or homeotic)-like, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.2kD AA Sequence: MHHHHHHEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISD PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNAR HEASAQ Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.