BPTF, Recombinant, Human, aa2791-2911, GST-tag (Bromodomain and PHD Finger Containing 4, FALZ, Fetal Alzheimer Antigen, Fetal Alz-50 Clone 1 Protein)
Catalog No : USB-298335
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BPTF, Recombinant, Human, aa2791-2911, GST-tag (Bromodomain and PHD Finger Containing 4, FALZ, Fetal Alzheimer Antigen, Fetal Alz-50 Clone 1 Protein) | ||
|---|---|---|---|
| Catalog No | USB-298335 | ||
| Supplier’s Catalog No | 298335 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 41 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~90%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~90%) | ||
| Description | FALZ is a bromodomain-containing protein that is the histone-binding component of NURF (nucleosome-remodeling factor), a complex which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. Specifically recognizes H3 tails trimethylated on Lys4 (H3K4me3), which mark transcription start sites of virtually all active genes. May also regulate transcription through direct binding to DNA or transcription factors. High levels of FALZ were detected in fetal brain and in patients with neurodegenerative diseases. Source: Recombinant protein corresponding to a single bromodomain, aa2791-2911, from human BPTF, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSTEDA MTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATME ERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASR SH Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved