BRD9, Recombinant, Human, aa135-242, GST-tag (Bromodomain Containing 9)

Catalog No : USB-298373
587.37€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name BRD9, Recombinant, Human, aa135-242, GST-tag (Bromodomain Containing 9)
Catalog No USB-298373
Supplier’s Catalog No 298373
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 39
Storage -70°C
Other names
Grade Highly Purified
Purity Highly Purified (~95%)
Form Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.
Reactivity life 12 months
Note For reserch purpose only
Purity Highly Purified (~95%)
Description Recombinant protein corresponding to aa135-242 from human Bromodomain containing 9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~39kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSENESTPIQQLL EHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADF KLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAA Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.