SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1)
Catalog No : USB-298461
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SMARCA4, Recombinant, Human, aa1480-1603, GST-tag (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily A Member 4, BRG1) | ||
|---|---|---|---|
| Catalog No | USB-298461 | ||
| Supplier’s Catalog No | 298461 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 41.3 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~96%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~96%) | ||
| Description | Recombinant protein corresponding to a single bromodomain, aa1480-1603, from human SMARCA4, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAEKLS PNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKE RIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved