Batf3, Recombinant, Rat, aa1-133, His-Tag (Basic Leucine Zipper Transcriptional Factor ATF-like 3)
Catalog No : USB-372411
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Batf3, Recombinant, Rat, aa1-133, His-Tag (Basic Leucine Zipper Transcriptional Factor ATF-like 3) | ||
|---|---|---|---|
| Catalog No | USB-372411 | ||
| Supplier’s Catalog No | 372411 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 17.13 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens. Source: Recombinant protein corresponding to aa1-133 from rat Batf3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.13kD AA Sequence: MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved