GTF2A2, Recombinant, Human, aa1-109, GST-Tag (Transcription Initiation Factor IIA Subunit 2)
Catalog No : USB-373552
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GTF2A2, Recombinant, Human, aa1-109, GST-Tag (Transcription Initiation Factor IIA Subunit 2) | ||
|---|---|---|---|
| Catalog No | USB-373552 | ||
| Supplier’s Catalog No | 373552 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. Source: Recombinant protein corresponding to aa1-109 from human GTF2A2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD AA Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved