TCN1, Recombinant, Porcine, aa25-416, His-Tag (Transcobalamin-1)

Catalog No : USB-375512
527.60€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TCN1, Recombinant, Porcine, aa25-416, His-Tag (Transcobalamin-1)
Catalog No USB-375512
Supplier’s Catalog No 375512
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 46.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach. Binds to cobalamin and to cobalamin analogs such as cobinamide. Source: Recombinant protein corresponding to aa25-416 from porcine Transcobalamin-1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~46.3kD AA Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.