Forkhead Box Protein M1, Recombinant, Human, aa235-327, His-Tag (Q08050)
Catalog No : USB-370615
448.29€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Forkhead Box Protein M1, Recombinant, Human, aa235-327, His-Tag (Q08050) | ||
|---|---|---|---|
| Catalog No | USB-370615 | ||
| Supplier’s Catalog No | 370615 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. Source: Recombinant protein corresponding to aa235-327 from human Q08050, fused to His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. AA Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved