OTX2, Recombinant, Human, aa1-297, His-SUMO-Tag (Homeobox Protein OTX2)

Catalog No : USB-374571
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name OTX2, Recombinant, Human, aa1-297, His-SUMO-Tag (Homeobox Protein OTX2)
Catalog No USB-374571
Supplier’s Catalog No 374571
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 48.4
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'. Source: Recombinant protein corresponding to aa1-297 from human OTX2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.4kD AA Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.