TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24)
Catalog No : USB-298485
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24) | ||
|---|---|---|---|
| Catalog No | USB-298485 | ||
| Supplier’s Catalog No | 298485 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 15 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~93%) | ||
| Form | Supplied as a liquid in 50mM Tris-HCl, pH 8.0, 138mM sodium chloride, 2.7mM potassium chloride, 10% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~93%) | ||
| Description | The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa896-1014 from human bromodomain tripartite motif containing 24, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15kD AA Sequence: MHHHHHHGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLS TIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLY PEKRFPKPE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
© 2020 Imugex All Rights Reserved