BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF)
Catalog No : USB-298331
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BAZ1B, Recombinant, Human, aa1335-1450, GST-tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSCR9, WBSCR10, HWALp, WSTF) | ||
|---|---|---|---|
| Catalog No | USB-298331 | ||
| Supplier’s Catalog No | 298331 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 40.5 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | Purified (~80%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Purified (~80%) | ||
| Description | This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008] Source: Recombinant protein corresponding to aa1335-1450 from human BAZ1B, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSR RQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGS YRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved