BRPF1, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain and PHD Finger Containing 1)
Catalog No : USB-298382
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BRPF1, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain and PHD Finger Containing 1) | ||
|---|---|---|---|
| Catalog No | USB-298382 | ||
| Supplier’s Catalog No | 298382 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 15.1 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | Purified (~69%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Purified (~69%) | ||
| Description | Source: Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF EEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQAR RQAEKMG Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved