BRPF3, Recombinant, Human, aa576-701, GST-tag (Bromodomain and PHD Finger Containing 3)
Catalog No : USB-298384
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BRPF3, Recombinant, Human, aa576-701, GST-tag (Bromodomain and PHD Finger Containing 3) | ||
|---|---|---|---|
| Catalog No | USB-298384 | ||
| Supplier’s Catalog No | 298384 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 41.2 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | Purified (~80%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Purified (~80%) | ||
| Description | Source: Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSQVKV QQAAMELELMPFNVLLRTTLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMR RKLESHLYRTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAE NIG Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved