PCGF6, Recombinant, Human, aa2-350, GST-tag (Polycomb Group RING Finger Protein 6, Mel18 And Bmi1-Like RING Finger Protein, MBLR, RNF134)
Catalog No : USB-298443
710.36€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | PCGF6, Recombinant, Human, aa2-350, GST-tag (Polycomb Group RING Finger Protein 6, Mel18 And Bmi1-Like RING Finger Protein, MBLR, RNF134) | ||
|---|---|---|---|
| Catalog No | USB-298443 | ||
| Supplier’s Catalog No | 298443 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Sf9 insect cells | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 65.7 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | Purified (~86%) | ||
| Form | Supplied as a liquid in 40mM Tris, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 0.04% Tween 20, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Purified (~86%) | ||
| Description | Transcriptional repressor that modulates the levels of histone H3K4Me3 by activating KDM5D histone demethylase. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Source: Recombinant protein corresponding to aa2-350 from human PCGF6, fused to GST-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~65.7kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPLVPRGSPGEFEGVA VVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPE LEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPL YNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKVL ESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPA CQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved