GLI1, Recombinant, Human, aa921-1106, His-Tag (Zinc Finger Protein GLI1)

Catalog No : USB-373444
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name GLI1, Recombinant, Human, aa921-1106, His-Tag (Zinc Finger Protein GLI1)
Catalog No USB-373444
Supplier’s Catalog No 373444
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 23.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation. Source: Recombinant protein corresponding to aa921-1106 from human Zinc Finger Protein GLI1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.3kD AA Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.